SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257058193|ref|YP_003136081.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257058193|ref|YP_003136081.1|
Domain Number - Region: 534-562,594-607
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0296
Family Cytochrome c3-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257058193|ref|YP_003136081.1|
Sequence length 627
Comment hypothetical protein Cyan8802_0282 [Cyanothece sp. PCC 8802]
Sequence
MSLLLSIILTLQLALGLPFEFNSLAPNMIAQTIDELPKDEICLTSNETLDSVRKNLIKTL
EITQQKYPNIFNQTQQVELETILGDLKNETIRNEKINLDNLKTLVQPIITQSGNSAKVAL
QLESLYQIIPTITKFKNIILLGKEAKSRYPCLSYNILHLIEDHHSKIPVINPKNFTQMDL
DFLSWQSFIALNWPADSLGNPLKSEIIGNDLTSPRVWEFYKNVKKVFINPDPQNKDNPFH
QLSSTFLDQPTVPKACQGWLNNQVIASIQNRQIKVLSLSVNDQETTQSANILQAIPEVPL
IDKDKNYVLYEDVINEDEFNYIRDNKLYDADYQFNIKEIDFPASSETNLGAMEIRAAWRI
IPQNMPTNQQKRYYTQNALIYVPAKYTQNNQTICQIQKVGLIGFHIVRRMKYQPQWVWST
FEQVDNAPQQQAISTNLDSEKFSFWQPDCQKDKFGLDCVPNHEPEADYQHFLYCSSSQGA
TDQVDKNCLFTWSSEPPYASQFQPTQVESINLIQPNKIVLGNNQDWQELLKKIVDQKSCS
NSQENCHSVWQYYQLVGTQWRQASPNLTENLYTDFSPIQPFELTNTVMETYRQKASCVKC
HATAQTAGLSKKPANFSFLLRSAKSGK
Download sequence
Identical sequences gi|257058193|ref|YP_003136081.1| WP_012796719.1.62203 395962.Cyan8802_0282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]