SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257058196|ref|YP_003136084.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058196|ref|YP_003136084.1|
Domain Number 1 Region: 37-384
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.14e-45
Family Filamentous hemagglutinin FhaB, secretion domain 0.0075
Further Details:      
 
Domain Number 2 Region: 389-530,562-592
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.2e-17
Family Filamentous hemagglutinin FhaB, secretion domain 0.024
Further Details:      
 
Weak hits

Sequence:  gi|257058196|ref|YP_003136084.1|
Domain Number - Region: 795-895,932-955
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00141
Family Filamentous hemagglutinin FhaB, secretion domain 0.054
Further Details:      
 
Domain Number - Region: 698-782,822-847
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00753
Family Filamentous hemagglutinin FhaB, secretion domain 0.084
Further Details:      
 
Domain Number - Region: 591-671
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0104
Family P22 tailspike protein 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257058196|ref|YP_003136084.1|
Sequence length 1195
Comment filamentous hemagglutinin family outer membrane protein [Cyanothece sp. PCC 8802]
Sequence
MKQLTFFNSNNLKFRLTLISGIILLSTGLTIDSLEAQTSPIIPDNTLPINSQVTPNGNQL
IINQGTSAGNNLFHSFEAFSLPTGYEAFFNNSLAIQNIFSRVTGTSISNIDGIIRANGIA
NLFFLNPNGIIFGSNAQLDIGGSFFGSTANSILFEDNSEFSATNPNNSSLLSISMPIGLQ
FRDNSAQIQVQGAGHQLQLVDPLIFFSVQQPNNPNLGLQVQNGKTLALVGGLVNLEGGII
TAPEGNIELGGVKSGLVRLNSSGIGWTLDYQQVDNFQNIALTQKALVDTSGNSGGSIQVQ
GSQIALLDGSVIWIENRGSQPSGNIAIHSSQSVELKGLNGDRSTIFPSTIFTQAIGQGKG
GDILISTEQLNMDELSRVDALTLLGGARGGNLVLNARDSINMNSGSPLIDTSILSRTQFS
GDAGNITVSTNKLTITNGGTLISPSNIGTGNAGDVTVKAVEIEIIGVNPGNLVSSQISTP
TRDGNAGNVEINTARLILRDGGLVNSATLATGNAGSVRINASESVEISGTFPQSILASQI
SSSALIIDEALQQLFGIDPIPTGASGNVTVNTPQLTITNQGLISVRNDGTGDAGNLEINA
DSIVLDNQGGIAASTASGEGGNIFLNLGNNLRMNNSSFITATAGGGGNSGNITIDTPILI
LQNGATISALSILRQGGDIELEGLQTLEIRDNSEISVSTETGEAGSIGINQNQTPVKTVD
ITNGSRLAAQATQPQGEAGSISVNTTNLAVNQGSSISAANISGRTGGDINLLNLGRLEVN
GAEISATTRDGKAGNLAINQGQTPVKIIELNAGSLTVEATGMGESGNLTVNALSLNLQNN
AEISASTNFGQGGDITLEGLDTLEVNNSQISASTQAGRGGNLTIKTTNSVQLSGQGKLSV
EATQGGRAGNLSLETGQMSISERANVTVSSPQGQAGNLTIKANSLSLNNGFITAETGQSE
GEEGANITLRISDFITLENESLISATANGSADGGNIDIETPFLIVFPSSPNGSDIIAKAE
QGSGGRIAINSQGIFGIEEGRATPGNQRNDLDASSESGSTGEILLNRELDPNRGLVELPE
TIVDPNSLIAQNACQRGTQSEFSVTGRGGLPPSLNEDLSSEATQVDLVQPAPFKKSEVRS
QKLEVVSNSSGQTPVIPAQGWIFNEKGEIVLVAYDPTMTDSQRLRKQGNGCHQQS
Download sequence
Identical sequences 395962.Cyan8802_0285 gi|257058196|ref|YP_003136084.1| WP_012796722.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]