SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257058278|ref|YP_003136166.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058278|ref|YP_003136166.1|
Domain Number 1 Region: 4-286
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.66e-77
Family AstE/AspA-like 0.00000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257058278|ref|YP_003136166.1|
Sequence length 289
Comment aspartoacylase [Cyanothece sp. PCC 8802]
Sequence
MVKKIRNIALIGGTHGNEMTGVYLIKKFQKYPHLIERSSLKILTFLANPRAIEARQRYIE
TDLNRCFSREALDEPETFFYEQILAKNIDQKIRDHQTDLIIDLHSTTSQMGLTIIICDGH
PFHFQLVAYLTSLNPNIKVLRYRYAQENLLLRSLTELGFAIEVGAVAQGVLDAALFQQTE
QLIYHLLDGLEKYNQGDDFNGCKSLTLYQVIERIDYPRTGEDITAMIHPDLQFKDYHPLH
PGDPLFVTFEGETIHYQGDCTVYPVFINEAAYYEKGIAMCFTEKQEIIL
Download sequence
Identical sequences B7K3E1
gi|218245246|ref|YP_002370617.1| 395962.Cyan8802_0370 41431.PCC8801_0363 gi|257058278|ref|YP_003136166.1| WP_012593738.1.62203 WP_012593738.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]