SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257058336|ref|YP_003136224.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058336|ref|YP_003136224.1|
Domain Number 1 Region: 192-273
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.77e-20
Family Cold shock DNA-binding domain-like 0.0013
Further Details:      
 
Domain Number 2 Region: 27-128
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.24e-19
Family Cold shock DNA-binding domain-like 0.014
Further Details:      
 
Domain Number 3 Region: 107-187
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000011
Family Cold shock DNA-binding domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257058336|ref|YP_003136224.1|
Sequence length 302
Comment RNA binding S1 domain-containing protein [Cyanothece sp. PCC 8802]
Sequence
MTSDSTSRKSSQISFSMDDFAKALDQHDYTFEKGQVVRGTVVQHTSDGAYVDIGGKSSGF
VPLREASLDSTPNLAEVLPLNEEAEFLIISDQNSEGQVKLSCRQLQLQQAWEKVAEIAET
GKTVQMRVIGTNKGGVIGDVEGLRGFIPRSHLLEKDNLDALVGQLLTANFLEVNPDDNKL
VLSQRRVIMAAQMDKITAGNLITGKVAKIQPYGIFVDLNGVTGLLHITQISGLRIDDLNT
LFKFGQEIQVMILNIDEYKGRISLSTKVLENYPGEILEQFDEVMKTASARVEQALEKLQK
EE
Download sequence
Identical sequences B7JUD6
gi|257058336|ref|YP_003136224.1| gi|218245301|ref|YP_002370672.1| 395962.Cyan8802_0430 41431.PCC8801_0419 WP_012593793.1.62203 WP_012593793.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]