SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257058498|ref|YP_003136386.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058498|ref|YP_003136386.1|
Domain Number 1 Region: 435-608
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.02e-56
Family N-acetylmuramoyl-L-alanine amidase-like 0.000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257058498|ref|YP_003136386.1|
Sequence length 612
Comment N-acetylmuramoyl-L-alanine amidase [Cyanothece sp. PCC 8802]
Sequence
MRFHWLLLSLLSTLLVALPAEAGKLLYWRFESNQNRLIFTTDSQVQPRAQLIPNPTRIVL
DLPGVVLGRSAVEQLIGGAIKSVRVGQFNAQTTRLVIEMAPGYTLDPQQVKVRGISPTQW
TVDLPTPQRMGNSSTPTPLPTQSPTPERSLPGPSSRRSNDFQVTRNGLFVRLDRNGNDNQ
IRVNRSDDQQTIEISLGGVSLPKSLLNQSLPVNTYGVSDIQFEQNPTSPADARISLRVSP
DSPNWQGYYSRLGGLVLLPKGGLSQVQDLRPPEPSGNTPPVNNLAQSRKPIISAIELSNR
NTQLLIRANQSIRGTGNLDRRTGIYTIRIPNAQLSETLSGPELGRNSPIYELKVRQVDGN
TVEILVRPSLGIRFGSLTQANQQILALDIRSLSPSVRSPNPNPSPIDVSPPWNTSLPPLT
SYPSDSVSGTPRGRVLVVIDPGHGGKDPGAIGLGGLQEKNVILPISLDVSRLLQERGVQV
MLTRNADYFVSLQGRTQMANQARANIFVSIHANAVGGGRTEVNGLEVYYHGNRELADAIH
RSIRRTVNIRDRGVRQARFYVLRTSRMPSSLVEVGFVTGAEDNANLSNPAYRQQMAQAIA
QGILDYIQQKRL
Download sequence
Identical sequences B7JWN1
gi|257058498|ref|YP_003136386.1| WP_012593954.1.62203 WP_012593954.1.93053 395962.Cyan8802_0604 41431.PCC8801_0589 gi|218245462|ref|YP_002370833.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]