SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257058576|ref|YP_003136464.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058576|ref|YP_003136464.1|
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily PIN domain-like 8.69e-17
Family PIN domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257058576|ref|YP_003136464.1|
Sequence length 128
Comment PilT protein domain-containing protein [Cyanothece sp. PCC 8802]
Sequence
MKLLLDTHAFIWWDSNSSNLSKKALALCSDRNNILLLSLVSVWEIQIKSKLGKLTLNQSL
LTMIENQQKVNNVKILPIKLDAILKLETLTVYHKDPFDDLLIVQAMLENATLLSKDSKFS
DYPVNVEW
Download sequence
Identical sequences 395962.Cyan8802_0688 gi|257058576|ref|YP_003136464.1| WP_015783253.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]