SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257058632|ref|YP_003136520.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058632|ref|YP_003136520.1|
Domain Number 1 Region: 4-69
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000387
Family 7-Fe ferredoxin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257058632|ref|YP_003136520.1|
Sequence length 75
Comment 4Fe-4S ferredoxin [Cyanothece sp. PCC 8802]
Sequence
MPHTIVTETCEGVADCVDACPVACIHEGPGKNSKGTDWYWIDFNTCIDCGICLNVCPVEG
AIIPEERPDLQKTPQ
Download sequence
Identical sequences B7JXP4
WP_012594077.1.62203 WP_012594077.1.93053 gi|218245586|ref|YP_002370957.1| 395962.Cyan8802_0746 41431.PCC8801_0717 gi|257058632|ref|YP_003136520.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]