SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257058724|ref|YP_003136612.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058724|ref|YP_003136612.1|
Domain Number 1 Region: 27-167
Classification Level Classification E-value
Superfamily CheY-like 9.39e-34
Family CheY-related 0.0028
Further Details:      
 
Domain Number 2 Region: 180-337
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.54e-31
Family HD domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257058724|ref|YP_003136612.1|
Sequence length 343
Comment response regulator receiver modulated metal dependent phosphohydrolase [Cyanothece sp. PCC 8802]
Sequence
MISSLIKNYSVDLINANSVDIFGSSQPAKILVVDDHPFSRMMAVDLLNSDGYNVIETDGS
ADVVEAILANAPDLILLDVKMPNYNGFDLCQQLKQDQQTQTIPIILMTVVDDNQSRLRSQ
EVQADGFLSKPLERMVLLPEVELLVQRKRLYEWLDQMQQVLFLIAQAIEKRYSQEGSSCA
RVDQLAQTFGEYLNLSPVDINDLILAAHLHDIGTVMIPDAVLLKKGELTATERELIKQHV
LIGEQICKPLQNRRGIPQIIRHHHERWNGTGYPDGLSGDDIPWLAQVFQILDIYDALTSK
RPYKQALSPEEALKILTEEAEKGWRNPDLVKKFVSFIKVRSLE
Download sequence
Identical sequences B7JYM2
395962.Cyan8802_0839 41431.PCC8801_0810 gi|257058724|ref|YP_003136612.1| gi|218245677|ref|YP_002371048.1| WP_012594168.1.62203 WP_012594168.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]