SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257058753|ref|YP_003136641.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058753|ref|YP_003136641.1|
Domain Number 1 Region: 9-337
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.66e-118
Family TK-like PP module 0.000000000538
Further Details:      
 
Domain Number 2 Region: 341-533
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.47e-65
Family TK-like Pyr module 0.000000487
Further Details:      
 
Domain Number 3 Region: 537-670
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 9.16e-44
Family Transketolase C-terminal domain-like 0.000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257058753|ref|YP_003136641.1|
Sequence length 670
Comment transketolase [Cyanothece sp. PCC 8802]
Sequence
MVVATQSLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDKFMRFNPKNPKWF
NRDRFILSAGHGCMLQYALLYLTGYDSVTIEDIKQFRQWGSKTPGHPENFETEGVEVTTG
PLGQGIANGVGLALAEAHLAAKFNKSDATIVDHYTYVILGDGCNMEGVAGEACSIAGHWG
LGKLIALYDDNHISIDGSTDVAFTEDVSKRFEAYGWHVLHVENGNTDLAAIAKAIEEAKA
VTDKPSMIKVTTTIGYGSPNKQNTAGVHGAALGADEVALTRHNLGWQHEPFDIPQDVLGH
MNKAIDRGSSYEAEWNQAFAAYKAKYPAEAAEFERYLSNKLPDGWDKVLPTFTPEDKGIP
TRKHSEVCLNKLAPILPELIGGSADLTHSNLTEIKISGDFQKGHYENRNVHFGVREHAMG
AICNGMALHGSGLIPYGATFLIFTDYMRAAIRLSALSQAGSIWVMTHDSIGQGEDGPTHQ
PIETLASLRAIPDLTVIRPADGNECSGAYKVAIEKAKQHAPTLLAFTRQNVPNLAGTSIE
GVAKGAYAIVDCQGTPDIILIGTGSEVSLCVEAAAKLTSEGKKVRVVSMPSWELFEAQDA
AYKESVLPKAVTKRLSVEAGSSFGWAKYVGFGGDSVSIDRFGASAPGGTCMEKFGFSVDN
VLAKAKALLG
Download sequence
Identical sequences B7JYQ3
395962.Cyan8802_0870 41431.PCC8801_0843 gi|257058753|ref|YP_003136641.1| WP_012594198.1.62203 WP_012594198.1.93053 gi|218245708|ref|YP_002371079.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]