SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257058756|ref|YP_003136644.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058756|ref|YP_003136644.1|
Domain Number 1 Region: 2-577
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 1.96e-187
Family Prokaryotic type I DNA topoisomerase 0.00000000274
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257058756|ref|YP_003136644.1|
Sequence length 877
Comment DNA topoisomerase I [Cyanothece sp. PCC 8802]
Sequence
MPTLVIVESPTKARTIRNYLPKGYRVEASMGHVRDLPASADEVPAAYKDQSWSNLGINVE
NDFEPLYVIPKSKKKVVQDLKSALKETDELILATDEDREGESISWHLMELLNPKVPIKRM
VFHEITREAIQAALKNCRDIDQNLVRAQETRRILDRLVGYTVSPLLWKKIARGLSAGRVQ
SVAVRLLVQRERERLAFQSGGYWDLKALLEKDKSNFEAKLITLADKKIAQGSDFDPNTGK
IAQGRDVVLLNESEANALKERLDGKLWTVTKTEEKPTIRRPAPPFTTSTLQQESNRKLGI
SARDTMRIAQKLYEEGYITYMRTDSVHLSEQAITAARDCVTQKYGKEYLSPKPRQYTTKS
KGAQEAHEAIRPAGNQFRTPQETGLGGQEFALYDLIWKRTVACQMADARLTQIIVNLLVE
DAGFRSSGKRIDFPGFFRAYVEGSDDPEAALENQEVILPPLQEGDHPNCQQLDVLGHETQ
PPARYTEASLVKTLESEGVGRPSTYASIIGTIIDRGYAQMRSKALVPTFTAFAVVSLLEG
HFPDLVDTKFTSKMEQTLDEIATGEAQWLPYLKNFYLGDKGLDTQVKVKTEQIDPGVAKA
VTLENLAATVKIGKFGPYIEVNQGEEVVTASIPADLTPADLNPEQIATILKQKIEGPDKL
GLHPETGEGIFILTGTYGPYVQLGEVSDENPKPKRASLPKGVKPEDVTLEIAVGLLSLPR
LLGTHPETGAKIKASLGRFGPYVVHDQGKDGKDYRSLKAEDDILTVSLERALELLAQPKK
TRGGGRTAKKPLRELGAHPDDKEPVNIYEGPYGIYVKHGKVNAGLPEGETAETLTLETAL
ELLAAKAATKTKTTRKSTTTKSTTTRKRTSKTTQSKG
Download sequence
Identical sequences gi|257058756|ref|YP_003136644.1| WP_015783361.1.62203 395962.Cyan8802_0873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]