SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257058766|ref|YP_003136654.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058766|ref|YP_003136654.1|
Domain Number 1 Region: 168-507
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.55e-119
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000125
Further Details:      
 
Domain Number 2 Region: 15-161
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.61e-37
Family Anticodon-binding domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257058766|ref|YP_003136654.1|
Sequence length 573
Comment lysyl-tRNA synthetase [Cyanothece sp. PCC 8802]
Sequence
MSPNQPPKEPHSASSLEEIRATRLEKVEQLQQLGLVPYAYKWESTHTAANLQDKYATLKD
GEEVDLEVAIAGRIIARRVFGKLAFFSLQDETATIQLYLDKQQIDTSMTEVTDAFNTLKK
LTDTGDILGVVGTIKRTEKGELSVKVQTYTILTKSLLPLPDKWHGLTDTEKRYRQRYVDL
IVNPQVRQTFRRRAQITASIRRYLDENGFIEIETPVLQSEAGGAEARPFITYHNTLDMEL
YLRIATELHLKRLIIGGFEKVFELGRIFRNEGVSTKHNPEFTSIEVYQAYADYFDMMELT
EALITNAAQAVLGTLKLTYQEIEIDLSTPWRRVTMTDIVKEKTGLDFDSFTDFESAKEAA
KKAGIDVPNDCPSLGKLMNEAFEQKVEETLIQPTFILDFPVEISPLAKPHRSKKGLVERF
ELYIVGRELANSFSELTDPIDQRERLEKQAEQKASGDLEAQGVDEDFLTALEYGMPPTGG
LGIGIDRLVMLLTDSPSIRDVIAFPLLKSQSVTVKSFDYDADKKILRVEFTNGSIYQYHD
VPKSLYQALEKAPSKGQFFNAEIRDKFGFDREV
Download sequence
Identical sequences WP_015783364.1.62203 395962.Cyan8802_0883 gi|257058766|ref|YP_003136654.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]