SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257058844|ref|YP_003136732.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058844|ref|YP_003136732.1|
Domain Number 1 Region: 2-360
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.57e-56
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00052
Further Details:      
 
Domain Number 2 Region: 334-448
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.25e-32
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257058844|ref|YP_003136732.1|
Sequence length 475
Comment pyridine nucleotide-disulfide oxidoreductase dimerisation region [Cyanothece sp. PCC 8802]
Sequence
MAVDYDLVVIGGGSGGLVVASAAAQLKAKVALVEKNRLGGDCLWFGCVPSKSLIHASRIA
YQVQHSERFGVYTTPITINFQQAIAHVQKVIATIEPHDSPERFEGLGVEVIFGSGQFINK
NTFEINGQKLTARAFVIATGSRPAIPPISGLQEAGYLTNEQVFSLTECPESLAVIGGGPI
GCELGQALHRLGTKVTLINSRSQLLPKEDPDAAKVVEQQFIQEGIKIINNTRVENIEIIE
GKKAVDTGKEKILVDEILLAAGRSPNLESLNLEIAGVDYNQKGIKVNQKLQTTNPKIYAC
GDVIDGYQFTHVASHEAVTVLTNALFIPFSKVNYRVIPWATFTDPELARVGLSESEAREK
YGQDICVLKQDFTNVDRAQAEGSTIGFGKIITKNNGEILGAHLVGKAAGELIHEIVLAMS
NNLKVSALTGIHIYPTLSEVNSKTALLLKKQKFSQNIRLQNLLNQFFRLMRSLIH
Download sequence
Identical sequences gi|257058844|ref|YP_003136732.1| 395962.Cyan8802_0963 WP_015783401.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]