SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257058897|ref|YP_003136785.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257058897|ref|YP_003136785.1|
Domain Number 1 Region: 1-262
Classification Level Classification E-value
Superfamily DNase I-like 4.32e-84
Family DNase I-like 0.000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257058897|ref|YP_003136785.1|
Sequence length 262
Comment exodeoxyribonuclease III [Cyanothece sp. PCC 8802]
Sequence
MKVATWNVNSIRTRQPHVIDWLKTNNIDVLCVQETKVIDQDFPKTPFEELGYHLYIYGQK
AYNGVAIFSRQPLEDVTMGFTPIVGESLAEDFDEQKRVITGIFQGVRIVNLYVPNGSAVG
TEKYDYKLRWLKVLKQYLTQFLEKSKQELCICGDFNIALEDKDIYNSKSKEDHIMSSPLE
RESLKDILDLGLKDAFRKFTSEGGQFSWWDYRSGGFQRNRGWRIDHHYLTPKLYEKAISC
TIDIEPRKLTQPSDHAPVIVEF
Download sequence
Identical sequences B7K0S3
WP_012594339.1.62203 WP_012594339.1.93053 gi|218245849|ref|YP_002371220.1| gi|257058897|ref|YP_003136785.1| 395962.Cyan8802_1017 41431.PCC8801_0988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]