SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257059081|ref|YP_003136969.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257059081|ref|YP_003136969.1|
Domain Number 1 Region: 3-199,300-390
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.09e-85
Family Bacterial dinuclear zinc exopeptidases 0.0000239
Further Details:      
 
Domain Number 2 Region: 187-293
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 2.09e-29
Family Bacterial exopeptidase dimerisation domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257059081|ref|YP_003136969.1|
Sequence length 398
Comment amidohydrolase [Cyanothece sp. PCC 8802]
Sequence
MLSQIKDIAEKLSPRLIEIRRHIHAHPELSGQEYQTAAYVAGVLSSCGIHVQENVGKTGV
VGNLTGNGTDQRTVAIRTDMDALPIEERTNLDFASCKPGIMHACGHDVHTTVGLGTAMIL
AELAEHLPGNVRFLFQPAEEIAQGASWMVQDGAMREVKAIFGVHVFPSIPARSVGIRYGA
LTAAADDLEIFIQGESGHGARPHEAIDAIWIASQVITTLQQAISRTQNPLRPIVLTIGQI
NGGRAANVIADQVRMAGTVRSLHPETHANLPQWVEDIVANVCSTYNAKYEINYRRRVPSV
QNDMELTKILESASREAWGNGNVQILPEPSLGSEDFSLFLEHAPGSMFRLGVGFPDKANY
PLHHPQFEIDESAILTGVVTLAYSVYKYWQTEKSMSES
Download sequence
Identical sequences B7K2B0
gi|218246031|ref|YP_002371402.1| 395962.Cyan8802_1205 41431.PCC8801_1178 gi|257059081|ref|YP_003136969.1| WP_012594520.1.62203 WP_012594520.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]