SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257059261|ref|YP_003137149.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257059261|ref|YP_003137149.1|
Domain Number 1 Region: 1-187
Classification Level Classification E-value
Superfamily ITPase-like 5.23e-65
Family ITPase (Ham1) 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257059261|ref|YP_003137149.1|
Sequence length 190
Comment RdgB/HAM1 family non-canonical purine NTP pyrophosphatase [Cyanothece sp. PCC 8802]
Sequence
MKKLIVATSNPGKLREMQAYLTGLDWELQLKPDSLEIEEIGSTFSENACLKASQVAKALG
EWAIADDSGLAVDALNGAPGLYSARYGTTDTERIQRLLTELADNQQRQAQFICVVAIARP
DGSIALQTEGICSGEILTHPRGTGGFGYDPIFYVPQQKQTFAEMPPEVKHQISHRGQAFA
QLLPQLSTIN
Download sequence
Identical sequences 395962.Cyan8802_1396 gi|257059261|ref|YP_003137149.1| WP_015783626.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]