SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257059265|ref|YP_003137153.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257059265|ref|YP_003137153.1|
Domain Number 1 Region: 24-120
Classification Level Classification E-value
Superfamily Cytochrome c 0.0000087
Family Quinoprotein alcohol dehydrogenase, C-terminal domain 0.084
Further Details:      
 
Weak hits

Sequence:  gi|257059265|ref|YP_003137153.1|
Domain Number - Region: 64-69,152-162
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.000579
Family Cytochrome c3-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257059265|ref|YP_003137153.1|
Sequence length 177
Comment hypothetical protein Cyan8802_1400 [Cyanothece sp. PCC 8802]
Sequence
MFKLSKLSLIQPFKPVSLLVWLAIALWSIGLGWGITHTLEAIAASPDDAVSARFEAGKEL
YRETCGSCHLALPPDVLPTETWQKLLEKPNDHYGTSIPNLIRLSQLLIWDYLRTFSRPIP
TKNDPIPFYVAQSRYFKILHPRVEFTDPVTHKSCIVCHPGVKSFNFRTLTPQWDDAP
Download sequence
Identical sequences B7K4G6
gi|257059265|ref|YP_003137153.1| gi|218246216|ref|YP_002371587.1| 395962.Cyan8802_1400 41431.PCC8801_1370 WP_012594705.1.62203 WP_012594705.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]