SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257059319|ref|YP_003137207.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257059319|ref|YP_003137207.1|
Domain Number - Region: 34-59
Classification Level Classification E-value
Superfamily Pheromone-binding domain of LuxR-like quorum-sensing transcription factors 0.0262
Family Pheromone-binding domain of LuxR-like quorum-sensing transcription factors 0.015
Further Details:      
 
Domain Number - Region: 13-42
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0356
Family Di-heme elbow motif 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257059319|ref|YP_003137207.1|
Sequence length 83
Comment hypothetical protein Cyan8802_1456 [Cyanothece sp. PCC 8802]
Sequence
MIDAFSPSPPAWTQTAIHGVQFHCPRCHNKASQAQQVWINRRSPVMAEDYRRKWQEFYQC
ECGQAWWGWSSDRPPTNVNKPID
Download sequence
Identical sequences 395962.Cyan8802_1456 gi|257059319|ref|YP_003137207.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]