SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257059322|ref|YP_003137210.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257059322|ref|YP_003137210.1|
Domain Number 1 Region: 20-207
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.13e-76
Family HD domain 0.0000011
Further Details:      
 
Domain Number 2 Region: 196-412
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 8.66e-65
Family RelA/SpoT domain 0.0000164
Further Details:      
 
Domain Number 3 Region: 395-467
Classification Level Classification E-value
Superfamily TGS-like 6.05e-21
Family G domain-linked domain 0.035
Further Details:      
 
Domain Number 4 Region: 662-738
Classification Level Classification E-value
Superfamily ACT-like 0.0000000000149
Family AF1403 N-terminal domain-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257059322|ref|YP_003137210.1|
Sequence length 743
Comment (p)ppGpp synthetase I SpoT/RelA [Cyanothece sp. PCC 8802]
Sequence
MNVVTYPESKPVTLPLPDWLNQCLIAYQSDSNSEEISLICRAFNFAYQLHEGQYRKSGEP
YIAHPIAVAGLLRDLGGDKAMIAAGFLHDVVEDTDVTVEQIEENFGSEVRQLVEGVTKLS
KFNFSSKTEHQAENFRRMFLAMAKDIRVIVVKLADRLHNMRTLEHLKPEKQERIARETKE
IFAPLANRLGIWRFKWELEDLSFKYLEPEAYREIQSLVAEKRSDRETRLETIKEMLRQRL
QKIGVQVVELQGRPKHLYGIYHKMQRQQKGFNQIYDIAALRIIVKNNEDCYRALAVVHDA
FKPIPGRFKDYIGLPKPNRYQSLHTTVVGLTGRPLEVQIRTLEMHHIAEYGIAAHWKYKE
TGGSDHTELSEEDEKFTWLRQLLEWQKDLQDAQEYVDTLKDNLFDDDVYVFTPQGDVVAL
ARGSTPVDFAYRIHTEVGNHMKGARINEKWSVLDTPLHNGDIVEIITQKNCHPSLDWLNF
AVTPSARNRIRQWYKRSRREENVARGREMLEKELGKSGLDALLKSDPMQMVAERCNYQSV
EDLLAALGYGEITLNQVIKRWREVTAKTQENQTVEGFSNPCPPSSCPGKQSKSPIMGVEG
LVYNMAGCCHPLPGEAIIGIVTLGAKGISIHRQGCPNIETIPSDRLVPVRWNPTENQTCL
TTYPVDIAIEALDRVGVLKDILSRLSDNNINVRNAGVKTGRNKPAMISLRIDIRDRQQLE
CVINQIRNMSDILSIHRVNSLEA
Download sequence
Identical sequences B7K4M5
gi|257059322|ref|YP_003137210.1| 395962.Cyan8802_1459 41431.PCC8801_1433 WP_012594763.1.62203 WP_012594763.1.93053 gi|218246275|ref|YP_002371646.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]