SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257059348|ref|YP_003137236.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257059348|ref|YP_003137236.1|
Domain Number - Region: 2-85
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0989
Family L-arabinose binding protein-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257059348|ref|YP_003137236.1|
Sequence length 202
Comment hypothetical protein Cyan8802_1485 [Cyanothece sp. PCC 8802]
Sequence
MKIAILVEGSTEKFFKTKLCDFLKNYLNQQMPRLKFFKYDGPIPKQDKLKRIVENLLTGK
ASYDAVIALTDVYTGKQDFRDAADAKAQMMKWVDNNPQFYPHTALHDFEAWLLSYWSTIQ
ALAKHNRSAPSGSPETVNHQKPPSYHIKEIFKLGGRQDYDKTIHSQKILEKNDLMLAIQA
CPELKAFVNRIISLCDESKKIN
Download sequence
Identical sequences gi|257059348|ref|YP_003137236.1| 395962.Cyan8802_1485 WP_015783678.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]