SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257059378|ref|YP_003137266.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257059378|ref|YP_003137266.1|
Domain Number 1 Region: 1-250
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.22e-91
Family Tryptophan biosynthesis enzymes 0.000000714
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257059378|ref|YP_003137266.1|
Sequence length 267
Comment tryptophan synthase subunit alpha [Cyanothece sp. PCC 8802]
Sequence
MTSVSDCFQSLRDRRQCALIPFITAGDPDLETTAKALRLLDASGADLIELGVPYSDPLAD
GPVIQAAATRALGRGVKLEDVLGVVKEVSPEIKAPIILFTYYNPIFYRGVEAFLQQVKAA
GVQGLVVPDLPLEEAESLLKPAHEVGIAVTLLVAPTSPIERIEAIARQSQGFIYLVSVTG
VTGMRSQVTSRVKELLTSLRSATDKPIGVGFGISKPEHALQVKNWGADAVIVGSAMVKRL
AEGTPEEGLKAIGAFCQDLKQALKEDQ
Download sequence
Identical sequences B7JUK2
gi|218246331|ref|YP_002371702.1| WP_012594819.1.62203 WP_012594819.1.93053 gi|257059378|ref|YP_003137266.1| 395962.Cyan8802_1518 41431.PCC8801_1490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]