SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257059421|ref|YP_003137309.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257059421|ref|YP_003137309.1|
Domain Number 1 Region: 2-124
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.11e-54
Family Cold shock DNA-binding domain-like 0.00000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257059421|ref|YP_003137309.1|
Sequence length 125
Comment 30S ribosomal protein S12 [Cyanothece sp. PCC 8802]
Sequence
MPTIQQLIRSERSKLKKKTKSPALKQCPQRRGVCTRVYTTTPKKPNSALRKVARVRLTSG
FEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDAQGVKDRKQGRSKYGTK
RPKKA
Download sequence
Identical sequences B7JUP8
gi|257059421|ref|YP_003137309.1| WP_012594865.1.62203 WP_012594865.1.93053 395962.Cyan8802_1564 41431.PCC8801_1539 gi|218246377|ref|YP_002371748.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]