SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257059451|ref|YP_003137339.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257059451|ref|YP_003137339.1|
Domain Number - Region: 61-107,173-179
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0774
Family Di-heme elbow motif 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257059451|ref|YP_003137339.1|
Sequence length 194
Comment hypothetical protein Cyan8802_1595 [Cyanothece sp. PCC 8802]
Sequence
MSFNSLNHLLNALENKPEWAQYQRYQRLCQCWNQIIDSKVALHTRPLYLQRNIFWVATSS
AVWAQTLSLQRYTLLKQLNHRLSCDPLGDIRFSCAQWHDASSQGEKSPDLPHPSEVNLPN
SLRDDPQIPPAKTPQEAFERWRSLVQARSLFLPLCPQCHCPTPPGELQRWSICVHCAARQ
WQTNSLCPPDSPQD
Download sequence
Identical sequences B7JUT0
gi|218246409|ref|YP_002371780.1| WP_012594897.1.62203 WP_012594897.1.93053 gi|257059451|ref|YP_003137339.1| 395962.Cyan8802_1595 41431.PCC8801_1572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]