SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257059498|ref|YP_003137386.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257059498|ref|YP_003137386.1|
Domain Number 1 Region: 8-223
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.22e-79
Family D-ribulose-5-phosphate 3-epimerase 0.0000000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257059498|ref|YP_003137386.1|
Sequence length 234
Comment ribulose-phosphate 3-epimerase [Cyanothece sp. PCC 8802]
Sequence
MSQSTKPIVIAPSILSADFSRLGEEIQAVDKAGADWIHVDVMDGRFVPNITIGPLIVSAI
RPYTQKPLDVHLMIVEPEKYVADFAKAGADIISVHAEHNASPHLHRTLGQIKELGKQAGV
VLNPSTPLELIEYVLELCDLVLIMSVNPGFGGQSFIPAVVSKIRKLRQMCDERGLDPWIE
VDGGLKGGNTWQVLEAGANAIVAGSAVFNAPNYAEAIEGIRNSKRPAERELATV
Download sequence
Identical sequences B7JVY1
WP_012594943.1.62203 WP_012594943.1.93053 gi|218246455|ref|YP_002371826.1| gi|257059498|ref|YP_003137386.1| 395962.Cyan8802_1646 41431.PCC8801_1619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]