SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257059821|ref|YP_003137709.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257059821|ref|YP_003137709.1|
Domain Number 1 Region: 1-79
Classification Level Classification E-value
Superfamily Ribosomal protein S16 1.7e-26
Family Ribosomal protein S16 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257059821|ref|YP_003137709.1|
Sequence length 82
Comment 30S ribosomal protein S16 [Cyanothece sp. PCC 8802]
Sequence
MIKLRLKRYGKKREVSYRIVAINSSSRRDGRPLEELGFYNPRTDETRLNVPGIVKRLKEG
AQPTETVRSILQKAQVFEQVNA
Download sequence
Identical sequences B7JY30
gi|257059821|ref|YP_003137709.1| 395962.Cyan8802_1983 41431.PCC8801_1956 gi|218246779|ref|YP_002372150.1| WP_012595266.1.62203 WP_012595266.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]