SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257059919|ref|YP_003137807.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257059919|ref|YP_003137807.1|
Domain Number 1 Region: 7-135
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.88e-25
Family Tex RuvX-like domain-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257059919|ref|YP_003137807.1|
Sequence length 140
Comment resolvase RNase H domain-containing protein [Cyanothece sp. PCC 8802]
Sequence
MNIKPPEIILGFDPGRDKCGLAVRDQKDQILYHEVVSSEAAIATLKSVSQQYPIDLLVMG
NQTTSKQWKKQLESELSPTFPIVMVDERNSSLEARDRYWQMYPPQGLTRLIPQGMRLPPC
PIDDIVAILLIERYLNNTED
Download sequence
Identical sequences B7JZ15
gi|257059919|ref|YP_003137807.1| 395962.Cyan8802_2084 41431.PCC8801_2060 gi|218246877|ref|YP_002372248.1| WP_012595360.1.62203 WP_012595360.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]