SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257060170|ref|YP_003138058.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060170|ref|YP_003138058.1|
Domain Number 1 Region: 2-268
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 7.07e-64
Family Decarboxylase 0.0004
Further Details:      
 
Domain Number 2 Region: 292-476
Classification Level Classification E-value
Superfamily PRTase-like 1.61e-40
Family Phosphoribosyltransferases (PRTases) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257060170|ref|YP_003138058.1|
Sequence length 479
Comment bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein [Cyanothece sp. PCC 8802]
Sequence
MSFFEKLTQAITYHETLLVVGLDPNPEMMLQYHYNDCSPDSLKKQWSTWLKSIISETMGS
VCAYKPTLGFYQVLGALGLELLSEIIAEIPPDIPIILDAKHGDLNTSTIFAKAIFEQWKV
DAVTVSPYSGHDQVAPFLVYPDKGVFVLCHSSNPGAIALQEYPTPETPFYLQVVKEAKMW
GTIEQVLLEVGTTDVEVIKKIRSIAPERFILMRSIWSQKNQLETILTAGLNSNGDGLLIP
IPQDFLKADHLKEQVKTLNQEINRTRNQIMSQQNSCQLWTSDVCLFNPHPYQDLILQLYD
IGCLLFGEYVQASGATFSYYIDLRQIISNPQIFHQVLRAYADILDQLEFDRIAGIPYGSL
PTATGLSLMLHHPMIYPRKEIKAHGTRRLIEGEFNPGEKVVLIDDILITGKSVIEGAEKL
QSSGLIVKDIVVFIDHEENVKDKIESYGYTAYSVLKISEITETLYAAGRINQEQYQRLS
Download sequence
Identical sequences B7K1C0
gi|257060170|ref|YP_003138058.1| WP_012595583.1.62203 WP_012595583.1.93053 gi|218247100|ref|YP_002372471.1| 395962.Cyan8802_2347 41431.PCC8801_2296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]