SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257060208|ref|YP_003138096.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060208|ref|YP_003138096.1|
Domain Number 1 Region: 338-493
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.81e-19
Family HD domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257060208|ref|YP_003138096.1|
Sequence length 711
Comment glycyl-tRNA synthetase subunit beta [Cyanothece sp. PCC 8802]
Sequence
MFFLLEVGTEELPADFLNGAIAQWQERIPASLQEHFLTPNSITVYGTPRRLAVLIEGLAD
HQSDRTEVIKGPPAAAAFKDGQPTKAAEGFARKQAVDVATLEIRPTDKGDFVFIEKKIAG
RPTKAILQELIPSWINGLEGRRFMRWGDGDLRFPRPIRWLVTLCDGEVLPLELINGSTTI
ISDRVSYGHRILHPEPVSIPHGSEYRETLQSVYVEVDPHERRQTIEAGVKAVAQTLGGTA
EIYPELLQEVTNLVEYPTAVPGKFDEEFLELPTEVITTVMVTHQRYFAVKDQQGSLLPNF
ITISNGDRTKSEIIAAGNQRVIRARLADAQFFYHADCSEPLDTYLPQLETVTFQNELGTM
RDKVDRIMEIAQQIAQQLNLTPQQWDEIESTAMLCKVDLVTQMVYEFPELQGIMGQKYAL
VSGESESVAQGIFEHYLPRGADDIMPQSLTGQVVGLADRLDTLISIFGLGMIPTGSSDPF
ALRRAANAVINITWNSQLSINLAQLLAQGCADFITGHQDKTSPLEPLKGFFIQRIQTLLQ
EELKLDYDLVNAVLGDNDPEYQERALEDLLDVRDRAQFLQEIRNNGQLERIYETVNRSTR
LAAQGNLGFQELDPRKTVNPQLFQQRSENAFYQELIVLLPETLAAKSQRNYQLLVNGLTE
IAPTVSNFFDGEDSVLVMDEDPKIRQNRLNLLGILRNHSRTLADFGAIVKS
Download sequence
Identical sequences B7K2F9
WP_012595620.1.62203 WP_012595620.1.93053 gi|218247137|ref|YP_002372508.1| gi|257060208|ref|YP_003138096.1| 395962.Cyan8802_2388 41431.PCC8801_2337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]