SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257060452|ref|YP_003138340.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060452|ref|YP_003138340.1|
Domain Number 1 Region: 44-370,470-511
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.42e-53
Family FAD-linked reductases, N-terminal domain 0.0049
Further Details:      
 
Domain Number 2 Region: 350-459
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.83e-25
Family L-aminoacid/polyamine oxidase 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257060452|ref|YP_003138340.1|
Sequence length 516
Comment amine oxidase [Cyanothece sp. PCC 8802]
Sequence
MKRRDFLSLVAASAGSTYAAMIALDLLSQPAKASKKLELKPINQPKTVIVLGAGVAGLCA
AYELEKLGYNCIILEANNRVGGRCFTVRNTTKLTEIDGQTQRSTFDENLYFNAGATRIAQ
HHVTLDYCQELGVPIEPFNHVNEAAYYYQVDVGKLSNRKIRIREIKQDFLGYKNELLAKA
INQDTLDLELTKEDQEKLVTFLQLEGNLSPDLFYKGSRNRGYSTLPGASLNPGVIESPFD
LSAIIQYGFSWYILNETTFNHQISLLQIVGGIDQLSKAFVNKIKGKISLESPVQEIRKTT
TGVKIIYLDKQQKRQSITGDYCICTIPLTVLKSIPSDFSQPMKQAISSIPYMATSKVGLQ
FKRRFWEEDDRIFGGISYTNQNITQIFYPSDHFFSQKGILVGAYNYEEKAQYFGNLSIQE
REKLVLQQGSKIHPQYLEEFESGFYVPWHKLPYNLGGWAMYNTDMRKTVYPQLNQPDDHI
YLAGEHLSYYPGWITGSLESSRHVVAQLNERVHSLG
Download sequence
Identical sequences 395962.Cyan8802_2643 gi|257060452|ref|YP_003138340.1| WP_015784280.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]