SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257060488|ref|YP_003138376.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060488|ref|YP_003138376.1|
Domain Number 1 Region: 3-52
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0000303
Family Cytochrome c3-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257060488|ref|YP_003138376.1|
Sequence length 121
Comment hypothetical protein Cyan8802_2681 [Cyanothece sp. PCC 8802]
Sequence
MSSCPHCHNSIDSQAIRCPYCHKSLKAYGHPGIPLYQATQDEFLCDRCLYHEDDSCNYPQ
RPYAKTCTLYHDKSQPLIIETIPSLAPAHPLKAIQLWCLRHRGLLLIIGLILMSFLIALL
R
Download sequence
Identical sequences gi|257060488|ref|YP_003138376.1| 395962.Cyan8802_2681 WP_015784300.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]