SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257060493|ref|YP_003138381.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060493|ref|YP_003138381.1|
Domain Number 1 Region: 1-321,434-475
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.78e-62
Family FAD-linked reductases, N-terminal domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257060493|ref|YP_003138381.1|
Sequence length 490
Comment carotene 7,8-desaturase [Cyanothece sp. PCC 8802]
Sequence
MRVAIVGAGLAGMTTAIDLVDAGCEVEIFESRPFVGGKVGSWVDNDGNHLEMGLHVFFGC
YYNLFELMKKVGAIENLRLKEHTHTFINQGGRVGELDFRFLTGAPFNGLKAFFTTSQLST
VDKLSNSLALGISPIVRGLIDFNGAMKTIRELDAISFADWFRQHGGNNSSLKRMWNPIAY
ALGFIDTENISARCMLTIFLFFATKTEASVLRMLEGSPFEYLHKPIINYLETRGAKIYTR
RRVREVLFQENGDETQVTGMIVADGESEETITADAYLCACDVPGIQRLLPQDWRKWSVFD
NIYKLEAVPVATVQLRFDGWVTELHDPQKREQLKEAAGLDNLLYTADADFSCFADLALTS
PADYYREGQGSLLQLVLTPGDPFIKEKNEDIAHHVLNQVHQLFPSSRNLKMTWYSVVKLA
QSLYREAPGMDPYRPPQKTPIPNFFLAGSYTQQDYIDSMEGATISGRQAAKAILETAEKL
KSIPQPSTIR
Download sequence
Identical sequences B7K0B4
gi|218248183|ref|YP_002373554.1| 395962.Cyan8802_2686 41431.PCC8801_3430 gi|257060493|ref|YP_003138381.1| WP_012596658.1.62203 WP_012596658.1.93053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]