SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257060578|ref|YP_003138466.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257060578|ref|YP_003138466.1|
Domain Number - Region: 167-189
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00466
Family Di-heme elbow motif 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257060578|ref|YP_003138466.1|
Sequence length 209
Comment hypothetical protein Cyan8802_2777 [Cyanothece sp. PCC 8802]
Sequence
MTSLPSPNRQFKIPIRIIALIVLAVLTWFIVVSCGSTNAKQSHFTLQPDEISDYIFRIIK
SERTIYGKYVVQRMKSENIVHASENWQQERALPLPAQMFRMTAELASENSPFSYGSMSPW
SLNENNLPKTDFEKQAMQTVLDTGLPVKDYQIKDGKKYFTALYPDKAVAAACVDCHNNHP
IHKQRYPDKVFQVGDVMGGILINLPLDQE
Download sequence
Identical sequences B7JZ99
gi|257060578|ref|YP_003138466.1| WP_012596571.1.62203 WP_012596571.1.93053 395962.Cyan8802_2777 41431.PCC8801_3340 gi|218248095|ref|YP_002373466.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]