SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257060610|ref|YP_003138498.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060610|ref|YP_003138498.1|
Domain Number 1 Region: 24-101
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000497
Family Multidrug resistance efflux transporter EmrE 0.0087
Further Details:      
 
Domain Number 2 Region: 174-246
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000183
Family Multidrug resistance efflux transporter EmrE 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257060610|ref|YP_003138498.1|
Sequence length 249
Comment hypothetical protein Cyan8802_2811 [Cyanothece sp. PCC 8802]
Sequence
MKDFGLFDLSNPWILPHLIAYLLTNIWIILGISVLIISLSLYLTAISELDLSYVLPIHAS
SYVLNGVFAWLFLGESVSISRWLSTILIAFGVFFVGLSDSKTSQVKHPKTTKIGVQNFPA
FLVPFSLATSQTWLAIFAISFSDSAGDVLLALGMKRIGKIGNLPLKSMVKLVIKIITNPF
IIGGIFCQSLAFFCFIAVLSWADISFVRPATALTYVMSMLGAKFLLKETIQPSKLMGIVL
IGLGVLSHR
Download sequence
Identical sequences B7JZ65
395962.Cyan8802_2811 41431.PCC8801_3305 WP_012596537.1.62203 WP_012596537.1.93053 gi|257060610|ref|YP_003138498.1| gi|218248061|ref|YP_002373432.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]