SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257060635|ref|YP_003138523.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257060635|ref|YP_003138523.1|
Domain Number - Region: 28-129
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00126
Family Di-heme elbow motif 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257060635|ref|YP_003138523.1|
Sequence length 165
Comment HNH endonuclease [Cyanothece sp. PCC 8802]
Sequence
MGKVLVLNASYEPLNITSWRRAVVLLLKGKAEQLEHNGQFIYSGFPLPSVIRLRHYVRVP
YKEIPLTRRNILERDRHTCQYCHYRGEQLTLDHIIPRSRGGGDTWENLVAACVRCNVKKG
NRTPKEANMMLRCQPRRPYSSLHFELVKHTRGNLNHEWRKYVIGI
Download sequence
Identical sequences B7JZ45
gi|257060635|ref|YP_003138523.1| WP_012596517.1.62203 WP_012596517.1.93053 gi|218248041|ref|YP_002373412.1| 395962.Cyan8802_2838 41431.PCC8801_3285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]