SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257060639|ref|YP_003138527.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060639|ref|YP_003138527.1|
Domain Number 1 Region: 3-201
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-39
Family Beta-D-xylosidase C-terminal domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257060639|ref|YP_003138527.1|
Sequence length 222
Comment hypothetical protein Cyan8802_2842 [Cyanothece sp. PCC 8802]
Sequence
MIVDFSQATWINKPKIFEITDHSVSITTEPNTDFWQRSYYGFRNDNAPAILLENNLNFSF
AARVSFNYQRRFDQCGLIIYLNSDNWMKASIEYENKEFSRLGSVVTNLGYSDWATTDITT
SNIFWYRLSRRGSDFLIESSTDGNTFRQMRIFHLHSLGETSPEMAKVNPPEIADQPIKFG
LYACSPLNSSFKATFDNFRLDRCLWMSYHKEAKEIISDMTQQ
Download sequence
Identical sequences 395962.Cyan8802_2842 gi|257060639|ref|YP_003138527.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]