SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257060797|ref|YP_003138685.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060797|ref|YP_003138685.1|
Domain Number 1 Region: 26-244
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.1e-75
Family ABC transporter ATPase domain-like 0.00000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257060797|ref|YP_003138685.1|
Sequence length 248
Comment ABC transporter [Cyanothece sp. PCC 8802]
Sequence
MTAESLSLTKNALHSSSESPEYHPILIRLEEICKVYGSGDTTVHALNNINLTIEKGESCA
IMGASGSGKSTLMNIIGCLDHPTTGRYYLENLDVSGLPESQLATIRNQKIGFVFQQFHLL
PQLSALENVILPMVYAGIPPQERRDRATVALEKVGLAHRLHNKPNQLSGGQQQRVAIARA
IVNNPLLILADEPTGALDSQTTQEVLNIFEELHRTGITIIIVTHEADVADHCQRVIHFRD
GKIELMTS
Download sequence
Identical sequences B7JXA9
gi|218247882|ref|YP_002373253.1| WP_012596358.1.62203 WP_012596358.1.93053 gi|257060797|ref|YP_003138685.1| 395962.Cyan8802_3004 41431.PCC8801_3116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]