SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257060823|ref|YP_003138711.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060823|ref|YP_003138711.1|
Domain Number 1 Region: 2-301
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.52e-83
Family G proteins 0.000000108
Further Details:      
 
Domain Number 2 Region: 279-360
Classification Level Classification E-value
Superfamily TGS-like 5.01e-34
Family G domain-linked domain 0.0000713
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257060823|ref|YP_003138711.1|
Sequence length 363
Comment GTP-dependent nucleic acid-binding protein EngD [Cyanothece sp. PCC 8802]
Sequence
MLKAGIVGLPNVGKSTLFNALVANAKADAANFPFCTIEPNVGVVSVPDERLQVLANLSKS
EKIVPTRIEFVDIAGLVKGASQGEGLGNQFLANIREVDAIVHVVRCFDDDDIIHVSGSVD
PVRDIEVINLELALADLSQVEKRLERARKQAKGKKEAEAEIPALEKILAYLNEGKAARHV
SLNEEEEELIKPLGLLTRKPIIYAANVSEDDLATGNDWVKQVEGVAHNENAKVVIVSAQV
ESELVEISEEEKADYLESLGVKEGGLQSLIKATYELLGLRTYLTTGPQETRAWTIHAGMK
APQAAGVIHTDFERGFIRAETVAYDDLVACKTMVAAKEKGLVRSEGKDYVVQEGDVMLFR
FNV
Download sequence
Identical sequences B7JX83
WP_012596332.1.62203 WP_012596332.1.93053 395962.Cyan8802_3030 41431.PCC8801_3090 gi|218247856|ref|YP_002373227.1| gi|257060823|ref|YP_003138711.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]