SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257060841|ref|YP_003138729.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060841|ref|YP_003138729.1|
Domain Number 1 Region: 195-277
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.49e-23
Family Cold shock DNA-binding domain-like 0.0017
Further Details:      
 
Domain Number 2 Region: 28-127
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.73e-19
Family Cold shock DNA-binding domain-like 0.014
Further Details:      
 
Domain Number 3 Region: 117-188
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000246
Family Cold shock DNA-binding domain-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257060841|ref|YP_003138729.1|
Sequence length 331
Comment 30S ribosomal protein S1 [Cyanothece sp. PCC 8802]
Sequence
MVTQKTTTTQTIGFTHEDFAALLDKYDYHFNPGDIVPGTVFSMEPRGALIDIGAKTAAYI
PIQEMSINRVDNPEEVLQSNETREFFILTDENEDGQLTLSIRRIEYMRAWERVRQLQAED
ATVRSNVFATNRGGALVRIEGLRGFIPGSHISTREAKEDLVGEELPLKFLEVDEERNRLV
LSHRRALVERKMNGLEVGQVVVGSVRGIKPYGAFIDIGGVSGLLHISEISHDHIDTPHSV
FNVNDALKVMIIDLDAERGRISLSTKQLEPEPGDMLKNRDLVFEKAEEMAEKYRQKLRAE
AEGKAAPEEEELEIPSALESEDEDLVVSAAD
Download sequence
Identical sequences B7JX65
395962.Cyan8802_3048 41431.PCC8801_3072 gi|257060841|ref|YP_003138729.1| WP_012596314.1.62203 WP_012596314.1.93053 gi|218247838|ref|YP_002373209.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]