SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257060846|ref|YP_003138734.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060846|ref|YP_003138734.1|
Domain Number 1 Region: 409-587
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.1e-48
Family N-acetylmuramoyl-L-alanine amidase-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257060846|ref|YP_003138734.1|
Sequence length 591
Comment cell wall hydrolase/autolysin [Cyanothece sp. PCC 8802]
Sequence
MNRYLLNSTTLTLMIVGSYFGGMSLANAQQSLYLAYPPNNHETKAEQIFFIGTASPQGEV
LINGQRIQRSRRGHFAPSFPLKVGKNEFILQYNQEEIKISVNRLSAVPKIAEGVAFVDNS
LVPASNISRLLGEPVCFSAMAASDAKVSVKIHNQTIPLLPQLNTLELPHNSALLTNNNQP
INTSITKHEGCTSFSKIGQLENPKFELTLNNQTITQLGTGTVEILSPHQLEIVKITADKG
VTRTGSSTDYSRLTPLPQGTIAAITAKEGEWLRLDYGAWIHQNETQSLGISSPPKSLIKS
IQSRLVEGATEIIFPLQIPVPIIVKQESNKITLILHNTTAQTDTIRFPIDTIIKNLTWEQ
VTPNKIEYAFELKSKNQWGYDLKYEGTNLIFSLRHPPNMEPSTNQSLKGIKILLDPGHGG
QESGAKGPNGYPEKSVNLSVSQLLKQELVKRGATVYMTRETDKDVSLQERVNLINKLQPT
LSLSIHYNALPDGGDAMNTDGIGMFWYHPQAQDLSVFLHDYLTEKLNRPSYGVFWNNLAL
TRPHSTPSILLELGFMINPNEFEWIINDQEQQKLAKTLADGITKWFEQNKS
Download sequence
Identical sequences WP_015784487.1.62203 395962.Cyan8802_3053 gi|257060846|ref|YP_003138734.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]