SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257060959|ref|YP_003138847.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257060959|ref|YP_003138847.1|
Domain Number 1 Region: 79-428
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.92e-75
Family Extended AAA-ATPase domain 0.00000000801
Further Details:      
 
Domain Number 2 Region: 8-43
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000108
Family ClpX chaperone zinc binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257060959|ref|YP_003138847.1|
Sequence length 448
Comment ATP-dependent protease ATP-binding subunit ClpX [Cyanothece sp. PCC 8802]
Sequence
MSKYDSHLKCSFCGKSQEQVRKLIAGPGVYICDECVELCNEILDEELMDAPAAAVAGGGS
PKPDDSRPKRRPSRERLSFNQIPKPREIKKYLDEYVIGQDEAKKVLSVAVYNHYKRLSLA
SKPGEETSEDHIELQKSNILLMGPTGSGKTLLAQTLAQILDVPFAVADATTLTEAGYVGE
DVENILLRLLQVADLDVEEAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLE
GTIANVPPQGGRKHPYQDCIQIDTSNILFICGGAFVGLDKVIEQRRGKKSMGFIRPGDTN
QSKEKRAADLMQQAEPDDLVKFGMIPEFVGRIPVMASLEPLDEETLIAILTQPRNALVKQ
YQKLLKMDNVQLEFNKDAVRAIAQEAYRRKTGARALRGIVEELMLDVMYELPSRKDVQRC
LITKEMVEQRSTADLLVHPSSLPTPESA
Download sequence
Identical sequences B7JW74
gi|257060959|ref|YP_003138847.1| WP_012596185.1.62203 WP_012596185.1.93053 395962.Cyan8802_3173 41431.PCC8801_2923 gi|218247704|ref|YP_002373075.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]