SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257061241|ref|YP_003139129.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061241|ref|YP_003139129.1|
Domain Number 1 Region: 99-225
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.06e-35
Family NlpC/P60 0.0000073
Further Details:      
 
Domain Number 2 Region: 12-84
Classification Level Classification E-value
Superfamily Prokaryotic SH3-related domain 2.01e-21
Family Spr N-terminal domain-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257061241|ref|YP_003139129.1|
Sequence length 231
Comment NLP/P60 protein [Cyanothece sp. PCC 8802]
Sequence
MTSLDLLSPSVSGEYRSKCDLNLFNAVECKELATQAAKRRHFKVLTTTVTEKAVQVRLCE
DGYIAWLPLSEISQLEPAETAYQPNSLSRDEIELRLPEIIAFTKAAMEQPNYYLWGGTIG
PNYDCSGLMQKAFAMSGIWLPRDSYQQEDFTQRIDKNDLLPGDLIFFGEQKVNHVALYLG
DGYYIHSSGKEQGRNGIAIDVFSNQGDEVSRRYYNKFWSCGRVIKSYADCR
Download sequence
Identical sequences gi|257061241|ref|YP_003139129.1| 395962.Cyan8802_3470 WP_015784709.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]