SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257061296|ref|YP_003139184.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061296|ref|YP_003139184.1|
Domain Number 1 Region: 57-199
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 1.83e-49
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000152
Further Details:      
 
Domain Number 2 Region: 4-55
Classification Level Classification E-value
Superfamily UBA-like 2.64e-19
Family TS-N domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257061296|ref|YP_003139184.1|
Sequence length 250
Comment elongation factor Ts [Cyanothece sp. PCC 8802]
Sequence
MAEISAKQVKELRETTGAGMMDCKKALQENQGDMTKAIEWLRQKGITSAEKKSGRQTAEG
LVESYIHTGGRIGVLVEVNCETDFVARREEFKELVRNVAMQIAACPNVEYIQGSDIPEAV
VAKEKEIEMGRDDLGNKPDNIKEKIVQGRIEKRIKELCLLDQPYIRDQNVTVEELIKQTI
AQLGENIQVRRFTRFVLGEGIEKQEVDFAREVAEQAGQLAPEAESTTEETADATSETTTE
KSSAKKKKKK
Download sequence
Identical sequences 395962.Cyan8802_3527 WP_015784738.1.62203 gi|257061296|ref|YP_003139184.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]