SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257061334|ref|YP_003139222.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257061334|ref|YP_003139222.1|
Domain Number - Region: 3-48
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.018
Family Eukaryotic type KH-domain (KH-domain type I) 0.0087
Further Details:      
 
Domain Number - Region: 42-83
Classification Level Classification E-value
Superfamily Plasmid maintenance system epsilon/zeta, antidote epsilon subunit 0.0392
Family Plasmid maintenance system epsilon/zeta, antidote epsilon subunit 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257061334|ref|YP_003139222.1|
Sequence length 88
Comment hypothetical protein Cyan8802_3568 [Cyanothece sp. PCC 8802]
Sequence
MLKSLKQKVIVGQNGKIEVPATELIEGTTVEIIILVEPENEENETTYLLQSEANKKQLLK
SLENANQGNLIEVDLDEYEKNYLCSRSV
Download sequence
Identical sequences B7K406
WP_012595813.1.62203 WP_012595813.1.93053 gi|218247331|ref|YP_002372702.1| 395962.Cyan8802_3568 41431.PCC8801_2538 gi|257061334|ref|YP_003139222.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]