SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257061368|ref|YP_003139256.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061368|ref|YP_003139256.1|
Domain Number 1 Region: 369-575
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.04e-33
Family TK-like Pyr module 0.03
Further Details:      
 
Domain Number 2 Region: 46-311
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.95e-31
Family TK-like PP module 0.0031
Further Details:      
 
Domain Number 3 Region: 581-731
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000000000208
Family Transketolase C-terminal domain-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257061368|ref|YP_003139256.1|
Sequence length 732
Comment D-xylulose 5-phosphate/D-fructose 6-phosphate phosphoketolase [Cyanothece sp. PCC 8802]
Sequence
MTVASAIPTFCQGIQYFGNNLPNFEQYATEAAIKPGHTAISYPNDPNAVYQTLLAADALR
YLTLQTTATKASGHPGGFASIADGIAALVMLGYKNILTEVGHHAPGFYSNMFLDRSLEDM
GISTVQQMGERFREMHGLLGHLSGQIPGLLNPAGPLGQGQHFAMAGAKLHPGVLFPVTIG
DGGLGEPYIMSSFAHFNTAYPTVTNFLPILVWNGYSQEHHSMVSTKTNEEMIHYWQGNGF
QEVILVNAKDFDDTNQPGEYVDSTQFSLAKRLAFTQAILEATDKAAKSALGGKLTVLIVK
QLKGAGVHKRGAQAHNLYPGDTLEKDYIISALTERALSPEAWELVRTNFERSAGGPASHH
VVTEKELPLPELGQLPLTEFEIHGEKKVATTAMGELVVHVGKNDPNFVITNADGNAASGI
NNINIGLKIVHPTVDEVYFQEPGGQVYEPLSEDACAGLAVGLALFGARTLWCSYESFAIN
GLPIWQTVTQAMAELRRPTPSTITLFTAGALEQGRNGWTHQRPEIENYFAAMMRNGNIFP
LFPCDANSIQACYEWALQTKNKGITITASKSPLPVRTTLEQTRQALQDGGVILHNSEGNK
KVVFAVIGDMTLIPVFDAAIHLEDEGIGVKIVSVINPRRLYRPHDVAWETCTEKDSHFLD
DEGFENLFGGDALIGVTGGTSAMLEPIMLRSNSKRDTFAWKRGETTASAGEIMAFNGLTA
EALSKRAVELLS
Download sequence
Identical sequences WP_015784772.1.62203 gi|257061368|ref|YP_003139256.1| 395962.Cyan8802_3603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]