SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257061441|ref|YP_003139329.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061441|ref|YP_003139329.1|
Domain Number 1 Region: 4-234
Classification Level Classification E-value
Superfamily PHP domain-like 9.02e-34
Family PHP domain 0.013
Further Details:      
 
Domain Number 2 Region: 776-858
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 0.00000000000000687
Family Intein (protein splicing domain) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257061441|ref|YP_003139329.1|
Sequence length 874
Comment DNA polymerase III subunit alpha [Cyanothece sp. PCC 8802]
Sequence
MSFVGLHIHSDYSLLDGASQLNALVDRAVELEMPAIALTDHGVMYGAIELMKVCRNKGIK
PIIGNEMYVINEDIEVNKRHRKYHQVVLAKNTQGYKNLVKLTTISHLKGIQGKGIFARPC
INKELLTQYHEGLIVTSACLGGEVPQSILAGDTKQAKTVAKWYQKLFKDDYYLEIQDHGS
QEDRIVNRELVKIARDLGIKIIATNDSHFISCYDVEAHDALLCIQTGKLITEDKRLRYSG
TEYLKSAEEMALLFRDHLPDDVIEEAINNTLEVADKIEPYKNIFGEPRIPNYPVPSGHTP
DSYVEEIAWEGLLERLKCRSRGEISDVYKERLEYELKMLQRMGFSTYFLVVWDYIKYARD
NGIPVGPGRGSAAGSLVAYCLKITNIDPVHHGLLFERFLNPERKSMPDVDTDFCIERRDE
MIKYVTEKYGEANVAQIITFNRMTSKAVLKDVARVLDIPYSESDKMAKMIPVSRGKPTKL
KVMISDETPCPEFKERYDNDPQVRRWLDMAIRIEGTNKTFGVHAAGVVISSEPLDEIVPL
QKNNEGSVITQYFMEDLESLGLLKMDFLGLRNLTTIQKTAELIKQNRKVELDLDQLPLEE
RKALQIIAKGTAKKLPEDIQKTHKLLERGDLEGIFQLESSGMKQIVKDLKPSGIEDISSI
LALYRPGPLDAGLIPKFINRKHGQEPIKYEHRLLEPILKETYAVLVYQEQIMKMAQDLAG
YSLGEADLLRRAMGKKKISEMEKHREKFIEGAAKNGVIKEIAENLFTQMVQFAEYCLSYD
TEILTVEYGAIPIGKVVEENIDCTVYTVDKNGFVYTQNIAQWHLRGQQEVFEYYLDDGSI
LRATKDHQFMTLEGEMLPIHEIFERGLELKKIKI
Download sequence
Identical sequences B7K2P6
gi|218247224|ref|YP_002372595.1| WP_012595706.1.62203 WP_012595706.1.93053 395962.Cyan8802_3682 41431.PCC8801_2428 gi|257061441|ref|YP_003139329.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]