SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257061471|ref|YP_003139359.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061471|ref|YP_003139359.1|
Domain Number 1 Region: 343-535
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.35e-51
Family Ppx associated domain 0.001
Further Details:      
 
Domain Number 2 Region: 147-329
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.89e-43
Family Ppx/GppA phosphatase 0.0013
Further Details:      
 
Domain Number 3 Region: 20-143
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.84e-35
Family Ppx/GppA phosphatase 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257061471|ref|YP_003139359.1|
Sequence length 545
Comment Ppx/GppA phosphatase [Cyanothece sp. PCC 8802]
Sequence
MIQSPKANPSNSDRAQTCLLAAIDIGTNSIHMVVVEIDKTLPAFTILARQKDTVRLGEQE
PKSGKLTEEAIERAISSLQRCKDLATSMNVDYIVATATSATREASNGQIFIQRVKDEVGI
FVNLISGYEEARRIYLGVLSGMDFQDKPHVIIDIGGGSTEIILADAQEPRFLSSTKVGAV
RLTEELITTDPISDSEFAYLRAYVRGMLERPIDELRHKLKENEEPKLIGTSGTIETLATI
HAVETLGEVPNPLQGYQMSRQEVKALVKRFAAMTYQERLAVPGMSDKRAEIIVAGGTVLM
EAMSILSLDNITLCERALREGMIVDWMLTHGLIEDRLKYQSQVRQRSVKKIARKYQVDLE
YTERVAEFAWSLFEQLKGILHDWGMEQWELLWSASILHNCGLYVSHSAHHKHSYYLIRNA
ELLGFTEVELETIANIARYHRKSTPKKKHEPYNKLPEIYRKMVRQLSAILRLAVALDRRQ
IGAIKTIECKYDAEYKKLHLHLFPTNPKDDCSLELWSLDYNKEVFEQEFVVKFVVTLATS
SGSFN
Download sequence
Identical sequences B7K2R9
WP_012596878.1.62203 WP_012596878.1.93053 395962.Cyan8802_3712 41431.PCC8801_3658 gi|218248405|ref|YP_002373776.1| gi|257061471|ref|YP_003139359.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]