SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257061491|ref|YP_003139379.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061491|ref|YP_003139379.1|
Domain Number 1 Region: 162-337
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.98e-57
Family N-acetylmuramoyl-L-alanine amidase-like 0.0000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257061491|ref|YP_003139379.1|
Sequence length 338
Comment N-acetylmuramoyl-L-alanine amidase [Cyanothece sp. PCC 8802]
Sequence
MKPIQGIVWGIVTSQTICLSVAANTLQYWDFDVRQNRVEIVTDSDVRPKAQMIANPTRLI
IDLPGVKLSQPSVRQGNITSYVRQVRVGQFSPYTTRIVVELGSAYSMRPWEVKVRSLAPN
RWFVQLSEFQPHSVYSLPPEAEPVAIAVPTPKPYPSTPSGAGYTVVIDPGHGGKDPGAIG
LGGLQEKDVVLSISLQLAEILKKRGVRVIMTRSNDASVSLKGRVEQAETANANVFVSIHA
NAVGGNNSQVNGLETYYYSSGYRLALTIHNNLLRKVNVVDNRGVKQARFYVLRKSSMPAA
LVEVGFVTGSIDNRNLSNPSYRQQLAEAIANGILDYLR
Download sequence
Identical sequences gi|257061491|ref|YP_003139379.1| 395962.Cyan8802_3732 WP_015784843.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]