SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257061661|ref|YP_003139549.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061661|ref|YP_003139549.1|
Domain Number 1 Region: 174-490
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.71e-113
Family Leucine aminopeptidase, C-terminal domain 0.000000442
Further Details:      
 
Domain Number 2 Region: 1-177
Classification Level Classification E-value
Superfamily Macro domain-like 6.47e-36
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257061661|ref|YP_003139549.1|
Sequence length 491
Comment leucyl aminopeptidase [Cyanothece sp. PCC 8802]
Sequence
MDIRGINTPFLDWTGDALALGIFEEGTQITGELSQLDGKLTGTLQELIQEAEFEGKAGTK
AVTRVGSNSPIRKVMLVGLGKAEDLQLNSVREAAGAIARLAKLEKVKTLGINLPVVNNDG
AKTASAIAEGILLALHQDNRFKSDPQENALKLENVDILGCGEATEAINRAQTLSSGVILA
RELVNSPANTITPVTFAETAQEIAQTSGLTCEILEQEDCEKLGMGSFLGVAKASDLPPKF
IHLTYKPSGTPKKKLAIVGKSLTFDCGGLNLKVAGASIEMMKMDMGGGAATLGAAKVIGQ
LKPDVEVHFICAATENMISGRAIHPGDILTASNGKTIEVNNTDAEGRLTLADALVFAEKL
EVDAIVDLATLTGACIIALGDNISGLWSTDQTLADQLKAAAETAGEKFWQMPLEEKYFEG
LKSPIADMKNTGPRAGGSITAALFLKQFIKDTPWAHLDIAGPVWAEKENGLNNVGGTGFP
VRTLVNWVLSF
Download sequence
Identical sequences gi|257061661|ref|YP_003139549.1| 395962.Cyan8802_3910 WP_015784948.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]