SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257061745|ref|YP_003139633.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061745|ref|YP_003139633.1|
Domain Number 1 Region: 249-628
Classification Level Classification E-value
Superfamily SIS domain 2.23e-103
Family double-SIS domain 0.000000155
Further Details:      
 
Domain Number 2 Region: 2-237
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.66e-67
Family Class II glutamine amidotransferases 0.00000293
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257061745|ref|YP_003139633.1|
Sequence length 628
Comment glucosamine--fructose-6-phosphate aminotransferase [Cyanothece sp. PCC 8802]
Sequence
MCGIVGYIGTQTATDILVSGLERLEYRGYDSAGVATVLEGKLHCVRAKGKLYNLREKLER
EVNPSQIGIGHTRWATHGKPEEHNAHPHRDSQQRVAVVQNGIIENHQELREELIDQGVEF
ASETDTEVIPHLIAQYLPETPGYDDFLIAVQKTIHRLKGSFAIAVLCADCPDELIVVRNQ
APLIIGFGQGEFFCASDVTALVPHTHAVLSMENGEIARLTPLGVEVYDFSLKRLRKLPRT
LDWTATTVEKQGFRHFMLKEIYEQPSVVRSCLETYLEPNWHAQTNADISPIDLGLASELC
ENVDYIQIVACGTSWNASMVGKYLLEQLAGIPTMVQYASEFRYAPAPMLPNTLTIGVTQS
GETADTLAALEMEKQRKMGLESPYDARILGITNRPESTLAHMVDRIINTQAGIEIGVAAT
KSFTAQLMGFYFLALELAYRRKHLALDKLEGLIKALRELPAQIELILEKQGTQIEELAHE
FADTQDFIFLGRGINFPIALEGALKLKEISYIHAEGYPAGEMKHGPIALLDAKVPVVAIA
MPGLVHDKVLSNAQEAKARDARLIGVTSIDDSEARSTFDDLLFVPHVDELLSPIIAVIPL
QLLAYHIAARRGLDVDQPRNLAKSVTVE
Download sequence
Identical sequences WP_015785013.1.62203 gi|257061745|ref|YP_003139633.1| 395962.Cyan8802_3995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]