SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257061839|ref|YP_003139727.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257061839|ref|YP_003139727.1|
Domain Number 1 Region: 105-159
Classification Level Classification E-value
Superfamily R3H domain 0.0000000471
Family R3H domain 0.0092
Further Details:      
 
Weak hits

Sequence:  gi|257061839|ref|YP_003139727.1|
Domain Number - Region: 46-99
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.005
Family Eukaryotic type KH-domain (KH-domain type I) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257061839|ref|YP_003139727.1|
Sequence length 162
Comment single-stranded nucleic acid binding R3H domain-containing protein [Cyanothece sp. PCC 8802]
Sequence
MEQPVHPGKAWLETLLKLMGFPAQVTVEEKNHESPESAECWLTIDETQLTPEQIEMILGN
HGEGIDAIQYLANTLINLSVEPEQQGGFMVELQGYRLQRQQELNDWVQQVAQQVRQTGQE
VEMTSLSSAERRQVHTMLKDAEDLETESRGQEPDRRLVVRLR
Download sequence
Identical sequences WP_015785059.1.62203 395962.Cyan8802_4098 gi|257061839|ref|YP_003139727.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]