SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|257061981|ref|YP_003139869.1| from Cyanothece sp. PCC 8802

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257061981|ref|YP_003139869.1|
Domain Number - Region: 9-64
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.000349
Family Di-heme elbow motif 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257061981|ref|YP_003139869.1|
Sequence length 80
Comment HNH endonuclease [Cyanothece sp. PCC 8802]
Sequence
MVKTPRIPIPESVREYVFQRDNYNCQSCGKNKQQVTLNVDHIIPLAKGGSNDISNLQTLC
KQCNQKKKHHIDPRFRRRFT
Download sequence
Identical sequences B7K683
gi|218248921|ref|YP_002374292.1| WP_015785184.1.62203 WP_015785184.1.93053 395962.Cyan8802_4247 41431.PCC8801_4208 gi|257061981|ref|YP_003139869.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]